PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_015451-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family HD-ZIP
Protein Properties Length: 282aa    MW: 31157.7 Da    PI: 5.9081
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_015451-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.83.7e-18101154356
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      k+++++ eq+++Le+ Fe  +++  e++ +LAk lgL+ rq+ +WFqNrRa++k
  AHYPO_015451-RA 101 KKRRLNMEQVKTLEKNFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWK 154
                      456899***********************************************9 PP

2HD-ZIP_I/II109.72e-35100168169
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkra 69 
                      ekkrrl+ eqvk+LE++Fe  +kLeperK++la++Lglqprq+a+WFqnrRAR+ktkqlEkdy+ +  +
  AHYPO_015451-RA 100 EKKRRLNMEQVKTLEKNFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWKTKQLEKDYDIIALK 168
                      69*************************************************************987554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.33E-1989158IPR009057Homeodomain-like
PROSITE profilePS5007116.76396156IPR001356Homeobox domain
SMARTSM003891.0E-1799160IPR001356Homeobox domain
CDDcd000866.54E-17101157No hitNo description
PfamPF000461.8E-15101154IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.4E-20103163IPR009057Homeodomain-like
PRINTSPR000319.8E-6127136IPR000047Helix-turn-helix motif
PROSITE patternPS000270131154IPR017970Homeobox, conserved site
PRINTSPR000319.8E-6136152IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009744Biological Processresponse to sucrose
GO:0048826Biological Processcotyledon morphogenesis
GO:0080022Biological Processprimary root development
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MMSSSCTGMA FFPANFMLQT PDNGTHPPSL SSILPSCTPQ DFHVGGAGIG GMLGKRSMSF  60
SGIDMCEDIT NGHNNNDNNG GDQEDLSDDG SHSHLGGVGE KKRRLNMEQV KTLEKNFELG  120
NKLEPERKMQ LAKALGLQPR QIAIWFQNRR ARWKTKQLEK DYDIIALKGG REPTESINLN  180
KETEGSCSNR SENSSEIKLD ISRTPTTNNE SPLDLSAHPT TTAGRTLFPQ SSMRPNGPLT  240
AQVLFQSPQS SSVKEENFTS MFCNIDDQTG FWPWIEHQNY N*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1148156RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00225DAPTransfer from AT1G69780Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010683230.11e-147PREDICTED: homeobox-leucine zipper protein ATHB-13
RefseqXP_010683229.11e-147PREDICTED: homeobox-leucine zipper protein ATHB-13
RefseqXP_010681986.11e-147PREDICTED: homeobox-leucine zipper protein ATHB-13-like
RefseqXP_010681985.11e-147PREDICTED: homeobox-leucine zipper protein ATHB-13-like
SwissprotQ8LC031e-93ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLA0A0J8C6V71e-135A0A0J8C6V7_BETVU; Uncharacterized protein
STRINGVIT_01s0026g01950.t011e-113(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.13e-92HD-ZIP family protein